Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: S47364_1.cds

[Submit comment/correction]

Sequence	S47364_1.cds
Peptide	MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAI LGFALTEAIALFALMMAFLILFVF
Structure From Source	S47364
Source Exons	1 225
Corresponding Protein	S47364_1.protseq
Gene Product	ATP synthase subunit 9
Remark	CDS note: Method: conceptual translation with partial peptide sequencing; ATP 9 [ Show all 6 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.