Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: S78730_1.cds

Sequence	S78730_1.cds
Peptide	DIGFMGCLTKNSSGKIVEAADIFVGGRIASDSHLTGVYKKAVPCEDLVPI VADLLVERFGAVPREREEDEE
Structure From Source	S78730
Source Exons	1 213
Corresponding Protein	S78730_1.protseq
Gene Product	nitrite reductase apoprotein
Remark	CDS note: This sequence comes from Fig. 1 [ Show all 6 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.