Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF003526_1.cds

Sequence	AF003526_1.cds
Peptide	KGKLPKDARLALVDWWNTHYRWPYPTINNWFVNQRKRHWKP
Structure From Source	AF003526
Source Exons	1 78 235 278
Corresponding Protein	AF003526_1.protseq
Gene Product	knotted-1 homeobox protein
Remark	DB_xref: GI:6746351 Feature: CDS: protein_id = 'AAF27529.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.