Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: U00966_1.cds

Sequence	U00966_1.cds
Peptide	MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVY VLVV
Structure From Source	U00966
Source Exons	1 165
Corresponding Protein	U00966_1.protseq
Gene Product	salt-stress induced hydrophobic peptide
Remark	DB_xref: GI:551068 Feature: CDS: citation = [3]; protein_id = 'AAA21847.1'; Gene: ESI3
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.