Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: U08169_1.cds

Sequence	U08169_1.cds
Peptide	QASRFLFRQNRVRMIADCHAAAVRVIQDPAMPQALCLVGSTLRSPHGCHA QYMANMGSIASLVMAVIISSGGEDEHNMTRGVIPSAMKLWGLVVCHHTSP RCIP
Structure From Source	U08169
Source Exons	1 312
Corresponding Protein	U08169_1.protseq
Gene Product	phytochrome
Remark	CDS note: chromophore binding region DB_xref: GI:1381126 Feature: CDS: protein_id = 'AAB02648.1'; Gene: PHYB/D
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.