Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: U26918_1.cds

Sequence	U26918_1.cds
Peptide	EPVLKYLKDIKWSRIDDPKGFKLEFFIDTNPFFKNSVLTKSYHMVDEDDP ILEKAIGTEIEWYPGKNVTQKILKKKPKKGSKNTKPITQKLKSARASSTF SAP
Structure From Source	U26918
Source Exons	1 312
Corresponding Protein	U26918_1.protseq
Gene Product	nucleosome assembly protein I
Remark	DB_xref: GI:904028 Feature: CDS: protein_id = 'AAA70363.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.