Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: U48787_1.cds

Sequence	U48787_1.cds
Peptide	RDALAKSIYACLFDWLVEQINKSLAVGKRRTGRSISILDIYGF
Structure From Source	U48787
Source Exons	1 129
Corresponding Protein	U48787_1.protseq
Gene Product	plant myosin WHM1
Remark	CDS note: head coding region DB_xref: GI:1224042 Feature: CDS: protein_id = 'AAA92117.1'; Gene: whm1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.