Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF016646_1.cds

Sequence	AF016646_1.cds
Peptide	KGKLPKDARLSLMNWWNTHYSWPYPTEEDKRRGRHDGLDQRQINNWFVNQ RKRHWKP
Structure From Source	AF016646
Source Exons	1 78 189 280
Corresponding Protein	AF016646_1.protseq
Gene	Knotted-1
Remark	CDS note: homeobox protein DB_xref: GI:3341721 Feature: CDS: protein_id = 'AAC27486.1'; Gene: Knotted-1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.