Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X07672_2.cds

Sequence	X07672_2.cds
Peptide	MATQTVEDSSKPRPKRTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALF AIFLSIILEIYNSSVLLDGILTN
Structure From Source	X07672
Source Exons	1 222
Corresponding Protein	X07672_2.protseq
Remark	CDS note: unnamed protein product; psbH protein (AA 1-73) [ Show all 11 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.