Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X13326_3.cds

Sequence	X13326_3.cds
Peptide	MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN
Structure From Source	X13326
Source Exons	1 117
Corresponding Protein	X13326_3.protseq
Gene	psbL
Remark	DB_xref: GI:12233 [ Show all 12 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.