Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X13443_1.cds

Sequence	X13443_1.cds
Peptide	MASDHRRFVLSGAVLLSVLAVAAATLESVKDECQLGVDFPHNPLATCHTY VIKRVCGRGPSRPMLVKERCCRELAAVPDHCRCEALRILMDGVRTPEGRV VEGRLGDRRDCPREEQRAFAATLVTAAECNLSSVQAPGVRLVLLADG
Structure From Source	X13443
Source Exons	1 444
Corresponding Protein	X13443_1.protseq
Gene Product	alpha-amylase/trypsin inhibitor preprotein
Remark	DB_xref: GI:18869 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.