Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X14108_2.cds

Sequence	X14108_2.cds
Peptide	MTIDRTYPIFTVRWLAIHGLAVPTVFFLGSISAMQFIQR
Structure From Source	X14108
Source Exons	1 120
Corresponding Protein	X14108_2.protseq
Remark	CDS note: unnamed protein product; psbF gene product (AA 1 - 39) [ Show all 13 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.