Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X14556_1.cds

Sequence	X14556_1.cds
Peptide	IVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRI
Structure From Source	X14556
Source Exons	1 131
Corresponding Protein	X14556_1.protseq
Remark	CDS note: ORF 70 (AA at 3) [ Show all 8 ]
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.