Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X14811_1.cds

Sequence	X14811_1.cds
Peptide	MKKKGGRKIFGFMVKEEKEENRGSVEFQVFSFTNKIRRLASHLELHKKDF SSERGLRRLLGKRRRLLAYLAKKNRVRYKKLIGQLNIREQ
Structure From Source	X14811
Source Exons	1 273
Corresponding Protein	X14811_1.protseq
Remark	CDS note: unnamed protein product; ribosomal protein S15 (alt. start site at 352) [ Show all 13 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.