Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X15225_1.cds

Sequence	X15225_1.cds
Peptide	MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSP RPNEYFTESRQGIPLITDRFDSLEQLDEFSRSF
Structure From Source	X15225
Source Exons	1 252
Corresponding Protein	X15225_1.protseq
Gene Product	cytochrome b-559 polypeptide
Remark	DB_xref: GI:14260 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.