Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X15225_4.cds

Sequence	X15225_4.cds
Peptide	MADTTGRIPLWLIGTVAGIAVIGLVGVFFYGSYSGLGSSL
Structure From Source	X15225
Source Exons	1 123
Corresponding Protein	X15225_4.protseq
Gene Product	hypothetical protein
Remark	CDS note: ORF40 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.