Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X16081_1.cds

Sequence	X16081_1.cds
Peptide	ALRGFGVIDSIKTQIEAICNQTVSCADILTVAARDSVVALGGPSWTVPLG RRDSIDANEAEANSDLPGFNSSRSELEAAF
Structure From Source	X16081
Source Exons	1 240
Corresponding Protein	X16081_1.protseq
Gene Product	putative peroxidase (AA 1-80)
Remark	DB_xref: GI:930271 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.