Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X52765_3.cds

Sequence	X52765_3.cds
Peptide	MPNILSLTCICFNSVLYPTSFFFAKLPEAYAIFNPIVDIMPVIPLFFFLL AFVWQAAVSFR
Structure From Source	X52765
Source Exons	1 186
Corresponding Protein	X52765_3.protseq
Gene Product	low molecular weight PSII psbK protein
Remark	DB_xref: GI:11605 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.