Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X54621_1.cds

Sequence	X54621_1.cds
Peptide	MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAI LGFALTEAIALFALMMAFLILFVF
Structure From Source	X54621
Source Exons	1 225
Corresponding Protein	X54621_1.protseq
Gene Product	ATPase subunit 9
Remark	CDS note: RNA editing alters this coding region in relation to the genomic coding region [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.