Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X54749_2.cds

Sequence	X54749_2.cds
Peptide	MEALVYTFLLVSTLGIIFFAIFFREPPKVPPTPTKRIK
Structure From Source	X54749
Source Exons	1 117
Corresponding Protein	X54749_2.protseq
Gene Product	putative transmembrane protein
Remark	DB_xref: GI:12358 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.