Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X54749_3.cds

Sequence	X54749_3.cds
Peptide	METATLVAISISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD
Structure From Source	X54749
Source Exons	1 132
Corresponding Protein	X54749_3.protseq
Gene Product	photosystem II polypeptide
Remark	DB_xref: GI:12359 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.