Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X59791_1.cds

Sequence	X59791_1.cds
Peptide	MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEE QACRIEMPGPPYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLM ELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGMEESQWS
Structure From Source	X59791
Source Exons	1 432
Corresponding Protein	X59791_1.protseq
Gene Product	CM 17 protein precursor
Remark	CDS note: conflicts with NH2 amino acid sequence reported by Barber D. et al. BBA 873, p. 147-151, 1986) [ Show all 10 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.