Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X61671_1.cds

Sequence	X61671_1.cds
Peptide	MGGGQKGLESAIVCLLVLGLVLEQVQVEGVDCGANPFKVACFNSCLLGPS TVFQCADFCACRLPAGLASVRSSDEPNAIEYCSLGCRSSVCDNMINTADN STEEMKLYVKRCGVACDSFCKGDTLLASLDD
Structure From Source	X61671
Source Exons	1 219 540 611 710 814
Corresponding Protein	X61671_1.protseq
Gene Product	wheat type V thionin
Remark	DB_xref: GI:21887 DB_xref: SWISS-PROT:Q05806 Feature: CDS: protein_id = 'CAA43845.1'; Gene: TthV
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.