Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X61674_2.cds

[Submit comment/correction]

Sequence	X61674_2.cds
Peptide	MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Structure From Source	X61674
Source Exons	1 111
Corresponding Protein	X61674_2.protseq
Gene	psbI
Gene Product	I protein
Remark	DB_xref: GI:14226 [ Show all 12 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.