Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X68654_1.cds

[Submit comment/correction]

Sequence	X68654_1.cds
Peptide	MARAAASQLVLVALVAAMLLVAADAAISCGQVSSALSPCISYARGNGAKP PAACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVS VPYAISASVDCSKIR
Structure From Source	X68654
Source Exons	1 348
Corresponding Protein	X68654_1.protseq
Gene Product	Cw-21 peptide,non specific lipid transfer protein
Remark	DB_xref: GI:443799 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.