Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X94973_1.cds

Sequence	X94973_1.cds
Peptide	MAGRKGGDRKKAVTRSVKAGLQFPVGRIGRYLKKGRYAQRIGSGAPVYLA AVLEYLAAEVLELAGNAAKDNKKTRIIPRHLLLAVRNDQELGRLLAGVTI AHGGVIPTINSVLLPKKSPAAAEKEAKSPKKKTSTKSPKKKVAAKE
Structure From Source	X94973
Source Exons	1 177 273 536
Corresponding Protein	X94973_1.protseq
Gene Product	histone H2A
Remark	DB_xref: GI:1325968 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.