Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X96442_1.cds

Sequence	X96442_1.cds
Peptide	MASGQEKGRSELDSLAREGQTVVPGGTGGKSYEAQEKLAEGRSRGGQTRK EQMGEEGYSEMGRKGGLSTNDESGGERAAREGIDIDESKFKTKS
Structure From Source	X96442
Source Exons	1 121 196 359
Corresponding Protein	X96442_1.protseq
Gene Product	Em protein
Remark	DB_xref: GI:4007840 Feature: CDS: protein_id = 'CAA65309.1'; Gene: Em-A1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.