Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X96445_1.cds

[Submit comment/correction]

Sequence	X96445_1.cds
Peptide	MGSKGLKGVMVCLLILGLVLEQVQVEGKSCCKSTLGRNCYNLCRARGAQK LCANVCRCKLTSGLSCPKDFPKLVLESNSDEPDTMEYCNLECRSSLCDYM VNAAADDEEMKLYVEQCGDACVNFCNADAGLTSLDA
Structure From Source	X96445
Source Exons	1 238 587 658 746 846
Corresponding Protein	X96445_1.protseq
Gene Product	beta purothionin
Remark	CDS note: type I [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.