Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X96446_1.cds

Sequence	X96446_1.cds
Peptide	MGSKGFKGVIVCLLILGLVLEQLQVEGKSCCRSTLGRNCYNLCRARGAQK LCAGVCRCKISSGLSCPKGFPKLALESNSDEPDTIEYCNLGCRSSVCDYM VNAAADDEEMKLYVENCADACVSFCNGDAGLPSLDAY
Structure From Source	X96446
Source Exons	1 238 579 650 742 845
Corresponding Protein	X96446_1.protseq
Gene Product	alpha purothionin
Remark	CDS note: type I [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.