Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Y09753_1.cds

Sequence	Y09753_1.cds
Peptide	KTWIGAVYPNFKEASLWNRYVTLFTWSITTLTTTGYGDFHAENPREMLFD IFFMMFNLGLTAYLIGNMTNL
Structure From Source	Y09753
Source Exons	1 214
Corresponding Protein	Y09753_1.protseq
Gene Product	potassium channel
Remark	CDS note: encodes membrane spanning domains H5-S6 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.