Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Y10814_1.cds

[Submit comment/correction]

Sequence	Y10814_1.cds
Peptide	MAARLMLVAALLCAATAMATAQQANNVRATYHYYRPAQNNWDLGAPAVSA YCATWDASKPLSWRSKYGWTAFCGPAGPLGQAACGKCLRVTNPATGAQIT ARIVDKCANGGLDLDWDTVFAKIDTNGIGFQQGHLNVNYQFVDCRD
Structure From Source	Y10814
Source Exons	1 441
Corresponding Protein	Y10814_1.protseq
Gene Product	pathogenesis-related protein 4
Remark	CDS note: In response to attack by Erysiphe graminis f.sp hordei [ Show all 11 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.