Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Y11600_1.cds

[Submit comment/correction]

Sequence	Y11600_1.cds
Peptide	KNYMIRTSLQCLALRREGDAIATQRQKAAFPPNFVHSLDSSHMMMTAITC KEAGLHFAGVHDSFWVHACDVDKMNQILREQFVELYSMPILENLLEEFQT LFPTVEFPPCPAQGNFDVREVLTSTYFFN
Structure From Source	Y11600
Source Exons	1 390
Corresponding Protein	Y11600_1.protseq
Gene Product	putative T7/T3-like RNA polymerase
Remark	DB_xref: GI:2239138 [ Show all 7 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.