Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Y12069_1.cds

[Submit comment/correction]

Sequence	Y12069_1.cds
Peptide	MASCSQHLLSAVAIFSVLAGVATATSIYTCYEGMGLPVNPLQGCRFYVAS QTCGAVPLLPIEVMKDWCCRELAGISSNCRCEGLRVFIDRAFPPSQSQGA PPQLPPLATECPAEVKRDFARTLALPGQCNLPAIHGGAYCVFP
Structure From Source	Y12069
Source Exons	1 432
Corresponding Protein	Y12069_1.protseq
Gene Product	trypsin inhibitor, BTICMc
Remark	DB_xref: GI:9650762 [ Show all 10 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.