Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Z48578_1.cds

[Submit comment/correction]

Sequence	Z48578_1.cds
Peptide	MDVPLASKVPLPSPSKHEQCNVYSHKSSSKHADLNPHAIDSVLGIILGGG AGTRLYPLTKKRAKPA
Structure From Source	Z48578
Source Exons	1 120 2935 3012
DB Remark	2.7.7.27
Corresponding Protein	Z48578_1.protseq
Gene Product	ADP-glucose pyrophosphorylase small subunit A (N-terminal)
Remark	DB_xref: GI:1143497 DB_xref: SWISS-PROT:P55238 Feature: CDS: protein_id = 'CAA88461.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.