Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Z50867_1.cds

[Submit comment/correction]

Sequence	Z50867_1.cds
Peptide	MASASRMLTVAVLAALFAGAMAVKVKLTVQKGSDKKKLALKIDYTRPNDS LSEVELRQYGSEEWQPLTKKGDVWEVSCSKPLVGPFNFRFLSKNGMKKVF DEVFSTDFKIGKTYEPEY
Structure From Source	Z50867
Source Exons	1 357
Corresponding Protein	Z50867_1.protseq
Gene Product	pollen allergen-like protein
Remark	DB_xref: GI:972513 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.