Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Z81495_6.cds

[Submit comment/correction]

Sequence	Z81495_6.cds
Peptide	MAAFLPIALSIAMLTVLTNANPIHPVPNAAFLPYRSCGSHLVHRAFEACS GKKDRSSDVDLWKMCCKDECTDLDIKESLCKYASQGYGVKFEEEAEEIDM VSFAAEGFKKSCGHDIVVKTVNVPTKISLKQCARTRGWRRRPRRIPDKFN RVQNYACINCVKIK
Structure From Source	Z81495
Source Exons	1 335 388 547
Corresponding Protein	Z81495_6.protseq
Gene	ins-37
Gene Product	C. elegans protein F08G2.6, partially confirmed by transcript evidence
Remark	CDS note: C. elegans INS-37 protein; contains similarity to Pfam domain PF03488 Nematode insulin-related peptide beta type contains similarity to Interpro domains IPR016179 (Insulin-like), IPR003235 (Nematode insulin-related peptide, beta type), IPR004825 (Insulin/IGF/relaxin) [ Show all 7 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.