Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF045927_1.cds

Sequence	AF045927_1.cds
Peptide	EVERRIVSQLLTLIDGLKSRAHVIVMGTTNRPNSIDPALRRFGRFDREID IGVPDEVGHLEVLRIHTKNMKLAEDVELEQ
Structure From Source	AF045927
Source Exons	1 240
Corresponding Protein	AF045927_1.protseq
Gene Product	cell division cycle protein 48
Remark	CDS note: similar to valosin containing protein and to Arabidopsis sp. cell division cycle protein 48 DB_xref: GI:2911393 Feature: CDS: protein_id = 'AAC04347.1'; Gene: CDC48
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.