Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF118118_1.cds

[Submit comment/correction]

Sequence	AF118118_1.cds
Peptide	MGPDELPKAAAAGAEEAAPFSFSIWPPTQRTRDAVVRRLVDTLAGDTLLC KRYGAVP
Structure From Source	AF118118
Source Exons	1 171
Corresponding Protein	AF118118_1.protseq
Gene Product	MFP1 attachment factor 1
Remark	CDS note: MAF1 DB_xref: GI:7546735 Feature: CDS: protein_id = 'AAF63662.1'; Gene: maf1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.