Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF159709_1.cds

[Submit comment/correction]

Sequence	AF159709_1.cds
Peptide	ELKRIENNMSRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGNLYE
Structure From Source	AF159709
Source Exons	1 150
Corresponding Protein	AF159709_1.protseq
Gene	MADS1
Gene Product	MADS-box transcription factor
Remark	DB_xref: GI:5712746 Feature: CDS: protein_id = 'AAD47631.1'; Gene: MADS1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.