Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF159712_1.cds

[Submit comment/correction]

Sequence	AF159712_1.cds
Peptide	GNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLESSLKH IRSRKNQLMPESISELQ
Structure From Source	AF159712
Source Exons	1 65 153 252 450 485
Corresponding Protein	AF159712_1.protseq
Gene	MADS2
Gene Product	MADS-box transcription factor
Remark	CDS note: contains K-box domain similar to domain in Arabidopsis thaliana apetala-1 protein DB_xref: GI:5712752 Feature: CDS: protein_id = 'AAD47634.1'; Gene: MADS2
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.