Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF348458_1.cds

[Submit comment/correction]

Sequence	AF348458_1.cds
Peptide	DTLLDADLESDALGWQYISGSLPDSRELDHIDNPQLEGYKFDPHGEYVRR WLPELARLPTE
Structure From Source	AF348458
Source Exons	1 105 208 285
Corresponding Protein	AF348458_1.protseq
Gene Product	cryptochrome 1a
Remark	DB_xref: GI:15559002 Feature: CDS: protein_id = 'AAL02089.1'; Gene: Cry1a
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.