Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF435815_1.cds

Sequence	AF435815_1.cds
Peptide	MGGCVGKGRGVVEEKLDFKGGNVHVITTKEDWDQKIEEANKDGKIVVANF SASWCGPCRVIAPVYAEMSKTYPQLMFLTIDVDDLMDFSSTWDIRATPTF FFLKNGQQIDKLVGANKPELEKKVQALGDGS
Structure From Source	AF435815
Source Exons	1 396
Corresponding Protein	AF435815_1.protseq
Gene Product	thioredoxin h-like protein
Remark	DB_xref: GI:24637225 Feature: CDS: protein_id = 'AAN63616.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.