Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF445772_1.cds

[Submit comment/correction]

Sequence	AF445772_1.cds
Peptide	IEMLSKLRHRHLVAMIGYCEEQKEMILVYEYMAKGTLRSHLYGSGLPPLT WKQRIDACIGAARGLHYLHTGADRGIIHRDVKTTNILLDKNFVAKIADFG LSKTGPTLDQTHVSTAIRGSFGYLDPEYFRRQQLTQKSDVYSFGV
Structure From Source	AF445772
Source Exons	1 434
Corresponding Protein	AF445772_1.protseq
Gene Product	kinase R-like protein
Remark	DB_xref: GI:17981540 Feature: CDS: protein_id = 'AAL51062.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.