Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF446141_5.cds

[Submit comment/correction]

Sequence	AF446141_5.cds
Peptide	MRACRPPAMARSAGLGRNRSYNGATAARDARRRWAATGTGRGAATYGTVT RAGTGARDGGGNVDGDGDGDGRASDGDGDGRARRGRGRASTTGTGQRDEE EEETN
Structure From Source	AF446141
Source Exons	1 10 719 1026
Corresponding Protein	AF446141_5.protseq
Gene Product	unknown
Remark	DB_xref: GI:21636164 Feature: CDS: evidence = not_experimental; protein_id = 'AAM69844.1'; Feature: CDS: inference = 'non-experimental evidence, no additional details recorded'; protein_id = 'AAM69844.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.