Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF473874_1.cds

[Submit comment/correction]

Sequence	AF473874_1.cds
Peptide	GLLALVASAAFAQYGEVVGSYEGGAGGGGAQQCPLGTKLDSCRNYLLDRC TTMKDFPVTWRWWTWWKGGCEELLHDCCSQLSQMPPQCRCNIIQGSIPRD LGGFFGFQRDRTVKVIQAAKNLPPRCNQGPACNIPSTIGYYW
Structure From Source	AF473874
Source Exons	1 431
Corresponding Protein	AF473874_1.protseq
Gene Product	hordoindoline A-8
Remark	CDS note: HINA-8 DB_xref: GI:20378935 Feature: CDS: protein_id = 'AAM21048.1'; Gene: hinA-8
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.