Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF474982_3.cds

[Submit comment/correction]

Sequence	AF474982_3.cds
Peptide	MDKDTETKFASAGTEEREGDDPGVPRRGSPLRAAAHTTTHTTSGRRRNPD MAEDARPLWPQLRGGGGEVRAVAQAQIEVSAVAHAEEEIGEKNNLRRGSL C
Structure From Source	AF474982
Source Exons	1 116 359 548
Corresponding Protein	AF474982_3.protseq
Gene Product	hypothetical protein
Remark	CDS note: gene 3 DB_xref: GI:19172016 Feature: CDS: evidence = not_experimental; protein_id = 'AAL85699.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.