Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF536819_1.cds

[Submit comment/correction]

Sequence	AF536819_1.cds
Peptide	MDVPLASKTFPSPSPSKREQCNIDGHKSSSKHADLNPHVDDSVLGIILGG GAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCL
Structure From Source	AF536819
Source Exons	1 123 2371 2502
Corresponding Protein	AF536819_1.protseq
Gene Product	cytosolic ADP glucose pyrophosphorylase
Remark	CDS note: AGP.S.1a; alternatively spliced DB_xref: GI:25271998 Feature: CDS: protein_id = 'AAN74741.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.