Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ000226_1.cds

[Submit comment/correction]

Sequence	AJ000226_1.cds
Peptide	VEKMCDLCSITLNKNAVFGDSSALSPGGVRIGAPAMTSRGLVEKDFEQIA EFLHQAVTICLNIQKEHGKLLKDFSKGLVNNKDIENLKVEVEKFALSFDM PGFTLESMKYK
Structure From Source	AJ000226
Source Exons	1 333
Corresponding Protein	AJ000226_1.protseq
Remark	CDS note: unnamed protein product; partial sequence, homology to serine hydroxymethyltransferases [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.