Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ000231_1.cds

[Submit comment/correction]

Sequence	AJ000231_1.cds
Peptide	GQRMCPGMNLVNHFDWELPIGIESIDMTEVFGITIRRKEKLLLIPKSRL
Structure From Source	AJ000231
Source Exons	1 150
Corresponding Protein	AJ000231_1.protseq
Remark	CDS note: partial sequence, homology to cytochrome P450 DB_xref: GI:2274995 DB_xref: SPTREMBL:O23988 Feature: CDS: protein_id = 'CAA03957.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.