Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AJ000240_1.cds

[Submit comment/correction]

Sequence	AJ000240_1.cds
Peptide	DVEYDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQL WKRFKGDGTPPANIGASRDYNVDMVPKFMMANGALVRVLIHTGVTKYLSF KAVDGSYVFNK
Structure From Source	AJ000240
Source Exons	1 336
Corresponding Protein	AJ000240_1.protseq
Remark	CDS note: unnamed protein product; partial sequence, homology to GDP dissociation inhibitor [ Show all 11 ]
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.